PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco004459.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family Nin-like
Protein Properties Length: 992aa    MW: 109147 Da    PI: 6.5902
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco004459.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.71.1e-28641692152
       RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  aek+isle+l++yF++++k+AAk+Lgvc+T++KriCRq+GI RWP+Rki+++
  Aco004459.1 641 AEKTISLEVLQQYFAGSLKNAAKSLGVCPTTMKRICRQHGILRWPSRKINKV 692
                  589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.086631712IPR003035RWP-RK domain
PfamPF020424.6E-25644692IPR003035RWP-RK domain
SuperFamilySSF542777.85E-22885980No hitNo description
SMARTSM006664.2E-21896978IPR000270PB1 domain
PROSITE profilePS5174520.981896978IPR000270PB1 domain
PfamPF005641.4E-15897977IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2405.0E-22897977No hitNo description
CDDcd064074.29E-33897977No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 992 aa     Download sequence    Send to blast
MESPPSPRPL PPPPPPPPLP RWCFLLRSMP GRDEEAAEAR GALMDLDDLD LDLDLDLDPD  60
PPSCLLPPRR PAPAADDAEW PFDALVSPSL LSSSSPPQSL LHLSFPSPPS PLCLFEDRPF  120
DASTSIAELA LYNPDTVSRN INGTNDKRRP LQLLVEEDNA DHTYIIKERM TQALRQFKES  180
TDQHLLVQVW APVKNGDRYV LTTSGQPFVL DHQSVALLQY RTVSLTYMFS VDGDNDGELG  240
LPGRVYRQKV PEWTPNVQYY SSKEYPRLCH ALNYNVRGTV ALPVFYPSAH TCVAVIELIM  300
TSQKINYAGE VGKVCKALEA VNLKSTEIQD HPSVQAKHPL SHVFVFLQGR FFLPNQICNK  360
GRQTALAEIL ETLAVVCEDH KLPLAQTWVP CRHRSVLAHG GGLRKSCSSF DGSCMGQVCM  420
STSDVAFHVI DAHIWRFRDA CVEHHLQKGQ GVAGIAFESR RPCFSEDITQ FSKTQYPLVH  480
YSRMCGLAGC FAVCLQSTFT GNDDYILEFF LPPECKNAGE QRVLLEAMII SMKRCFRSLK  540
VVADVELQEG ITLQSIDMLV IDNREFASGH PRASLECNFD KGFNGAGKLD NRVSDMPEKH  600
ILANGNAVNN GIVIEQNGSG TSSSSLANKN NKPSERRRGK AEKTISLEVL QQYFAGSLKN  660
AAKSLGVCPT TMKRICRQHG ILRWPSRKIN KVNRSLSKLK QVIESVDGAF TLPSLPCPLP  720
VAVGSLPSPS NVDKTNKTKE SEPLKPFTLH TERENKLSTR DTSPDNDGSG KKLFPHCSRS  780
GSSSEEGSSN THTSEGSCHA SPQNENVVSG PFNSTFLGPE LKPSCTLGLI NPNTNFICLN  840
TTAVEPQSPL NGMLVEDSGS SKYLKNLCPC AVEIPHDEHN VGPTSNNPTS MANSRVVTIK  900
ASYKDDIVRF RFTVAGNVTE LKDEIAKRLK LEVGMFDVKY LDDDPEWVLL ACNADLEECV  960
EIARLSGRHV VRLLVSDISA SLGSSCESSR G*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010915986.10.0PREDICTED: protein NLP3-like
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLA0A0E0JG460.0A0A0E0JG46_ORYPU; Uncharacterized protein
STRINGSi000216m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7